2644-20-4 Methane-13C,d4 DTXSID30482057 CAS 2644-20-4
| CAS No. | 2644-20-4 |
| Molecular Formula | [13C]D4 |
| Molecular Weight | 21.06 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
2644-20-4 Methane-13C,d4 DTXSID30482057 (CAS 2644-20-4), molecular formula [13C]D4 and molecular weight 21.06 g/mol, is a CATO reference standard with documented purity and traceability.
The molecular framework of 2644-20-4 Methane-13C,d4 DTXSID30482057 ([13C]D4) is characterized by deuterium isotope labeling. In reversed-phase chromatography, its retention is governed primarily by its non-polar molecular character, which provides a practical basis for HPLC-UV/DAD or LC-MS method development.
Recommended for analytical method development and validation; each product is supplied with a full Certificate of Analysis (COA) ensuring ISO 17034 metrological traceability.
As a certified reference material (CRM), 2644-20-4 Methane-13C,d4 DTXSID30482057 meets the metrological traceability requirements of ISO/IEC 17025 laboratories. Batch-to-batch consistency is monitored via control charts to guarantee comparable assigned values across lots.
Physical & Chemical Properties
| Molecular Formula | [13C]D4 |
| Molecular Weight | 21.06 g/mol |
| Purity | 97%+ |
| Storage | Store at 2-8°C |
| Solubility (reference) | Soluble in methanol, acetonitrile, DMSO |
| Stability | Stable under recommended storage conditions |
| Degree of Unsaturation (DBE) | 2.0 |
| CAS Registry Year (est.) | 1957 |
Related Methane Standards
- Methane-d4 (gas) (CAS 558-20-3)
- Methane-d3 (gas) (CAS 676-80-2)
- Methane-d2 (gas) (CAS 676-55-1)
- Methane-d1 (gas) (CAS 676-49-3)
- Methane-d₃-thiol (CAS 73142-81-1)
- 66178-40-3 Methane(~2~H)sulfonic acid DTXSID00745808 (CAS 66178-40-3)
- 421-14-7 Methane, trifluoromethoxy- Ether, methyl trifluoromethyl Methyl perfluoromethyl ether Methyl trifluoromethyl ether Trifluoromethoxymethane Trifluoromethoxymethone (CAS 421-14-7)
- 35668-13-4 Methane-d3-sulfonyl chloride DTXSID60464280 (CAS 35668-13-4)
Recommended Standards
- 99210-65-8 CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKE Interferon alpha 2b Intron A Sch 30500 (CAS 99210-65-8)
- Diborane (CAS 19287-45-7)
- Ammonia-¹⁵N,d₃ (CAS 22364-56-3)
- 917-54-4 Methyllithium, complexed with lithium bromide, 1.5M in ethyl ether MFCD00008253 (CAS 917-54-4)
- (2S,4R)-4-(2-Nitrobenzyl)pyrrolidine-2-carboxylic acid (CAS 1049978-67-7)
- Acemetacin (CAS 53164-05-9)
- (S)-N-Isopropyl-N-(pyrrolidin-2-ylmethyl)acetamide (CAS 1353999-76-4)
- N'-(1-([1,1'-Biphenyl]-4-yl)ethylidene)-2-(4-benzylpiperazin-1-yl)acetohydrazide (CAS 303107-60-0)
- n-((6-Methylpyridin-3-yl)methyl)-3-phenylprop-2-en-1-amine (CAS 1375273-69-0)
- 2,7-Dibromo-9-(4-bromophenyl)-9H-carbazole (CAS 1313900-20-7)
- N-(Pyrazolo[1,5-a][1,3,5]triazin-4-yl)hydroxylamine (CAS 71774-62-4)
- 1,7-dimethyl-4-oxo-1H,4H,7H-pyrazolo[3,4-b]pyridine-5-carboxylic acid (CAS 1798702-11-0)
- Tenofovir disoproxil Impurity 132 (CAS CATO-C4X-1076132)
- Thymopoietin II Peptide Fragment (CAS 56795-64-3)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com