3-methyl-4,5-dihydro-5-isoxazolecarboxylic acid 774-67-4 CAS 774-67-4
Purity 97%+In StockPharmaceutical Standards
| CAS No. | 774-67-4 |
| Molecular Formula | C10H20N2O |
| Molecular Weight | 184.28 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
3-methyl-4,5-dihydro-5-isoxazolecarboxylic acid 774-67-4 (CAS 774-67-4) is a pharmaceutical standards certified reference material from CATO. Molecular formula: C10H20N2O. Molecular weight: 184.28 g/mol. ISO 17034 accredited production ensures traceable purity and reliable analytical results.
Physical & Chemical Properties
| Molecular Formula | C10H20N2O |
| Molecular Weight | 184.28 g/mol |
| Purity | 97%+ |
| Storage | Store at 2-8°C, protect from light |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | Light-sensitive; avoid direct strong light |
| Degree of Unsaturation (DBE) | 2.0 |
| CAS Registry Year (est.) | 1957 |
| Nitrogen Atoms | 2 |
Related methyl Standards
- (6S)-5,6-Dihydro-6-methyl-4H-thieno[2,3-b]thiopyran-4-one (S)-6-methyl-5,6-dihydro-4H-thieno[2,3-b]thiopyran-4-one 147086-79-1 (CAS 147086-79-1)
- 2-(6,7-Dihydro-4h-pyrano[4,3-d]thiazol-2-yl)ethan-1-amine (CAS 1155636-60-4)
- 3-(2,3-dihydro-1H-inden-5-yl)-1H-pyrazole (CAS 1007074-30-7)
- 3-Phenyl-5,6-dihydro-4H-pyrrolo[1,2-b]pyrazole (CAS 10183-74-1)
- 2-Phenyl-6,7-dihydro-5H-pyrrolo[1,2-a]imidazole (CAS 107392-72-3)
- 2-Methyl-2,3-dihydro-1H-cyclopenta[b]quinoxaline (CAS 109682-72-6)
- 2',3'-Dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-8'-carbonitrile (CAS 1203686-35-4)
- 2',3'-Dihydro-1'H-spiro[cyclopropane-1,4'-isoquinoline]-7'-carbonitrile (CAS 1203686-91-2)
Recommended Standards
- 1800AC 2-(Piperazin-1-yl)cyclohexanol 759402-42-1 C10H20N2O (CAS 759402-42-1)
- 81028-03-7 cis-2-Buten-1,4-diol-monobenzyl ether cis-4-Benzyloxy-2-buten-1-ol (CAS 81028-03-7)
- 70817-26-4 AR-1H6860 aluminum decan-1-ide(1z)-dodec-1-en-1-ide(1:2:1) (CAS 70817-26-4)
- 1-Methoxypent-4-yn-2-amine (CAS 1247755-05-0)
- N-(2-carbamothioylethyl)-N-(propan-2-yl)acetamide (CAS 1225846-65-0)
- 3-(5-Amino-4H-1,2,4-triazol-3-yl)benzonitrile (CAS 1016517-38-6)
- 5-(3-Isopropoxyphenyl)-5-oxopentanoic acid (CAS 845790-43-4)
- TDPQDDSDDDVDDPDDRQQTPDVVPDDSGTFYDQTVSNDLD (CAS CATO-CPTD788897)
- 4-(3-Methylbutanoyl)-N-[(oxolan-2-yl)methyl]-1H-pyrrole-2-carboxamide (CAS 478259-13-1)
- Protein Kinase C? Peptide Substrate (CAS 120253-69-2)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 13829788188 / jacky.chen@cato-chem.com