TRPQRRSRRRVRRPRRRQQTPRVVPDDSGTFYDQTVSNDLR CAS CATO-CPTD788899
| CAS No. | CATO-CPTD788899 |
| Molecular Formula | C209H355N85O63 |
| Molecular Weight | 5066.59 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
Under current pharmacopoeial and regulatory frameworks, quality-control requirements for this class of reference material explicitly involve the control of targets including TRPQRRSRRRVRRPRRRQQTPRVVPDDSGTFYDQTVSNDLR.
CATO supplies TRPQRRSRRRVRRPRRRQQTPRVVPDDSGTFYDQTVSNDLR (CAS CATO-CPTD788899), a certified reference material (molecular formula C209H355N85O63, MW 5066.59 g/mol) for analytical method development and quality control.
Structurally, TRPQRRSRRRVRRPRRRQQTPRVVPDDSGTFYDQTVSNDLR (C209H355N85O63) contains a nitrogen-containing heterocyclic scaffold, an amide group, a hydroxyl group, an ether linkage. The molecule exhibits a degree of unsaturation (DBE) of 75.0, corresponding to approximately 75 ring(s) or double-bond equivalent(s). With a molecular weight of 5066.59 g/mol, it falls into the high-molecular-weight range. The aromatic system may exhibit native fluorescence, enabling detection with a fluorescence detector (FLD).
Recommended for analytical method development and validation; each product is supplied with a full Certificate of Analysis (COA) ensuring ISO 17034 metrological traceability.
As a certified reference material (CRM), TRPQRRSRRRVRRPRRRQQTPRVVPDDSGTFYDQTVSNDLR meets the metrological traceability requirements of ISO/IEC 17025 laboratories. Batch-to-batch consistency is monitored via control charts to guarantee comparable assigned values across lots.
Physical & Chemical Properties
| Molecular Formula | C209H355N85O63 |
| Molecular Weight | 5066.59 g/mol |
| Purity | 97%+ |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 75.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| Nitrogen Atoms | 85 |
Recommended Standards
- Tirzepatide Impurity 35 (CAS CATO-C4X-324035)
- Tirzepatide Impurity 61 (CAS CATO-C4X-324061)
- Tirzepatide Impurity 57 (CAS CATO-C4X-324057)
- Pancreastatin, porcine (CAS 106477-83-2)
- 8-chloro-1,7-naphthyridine (CAS 13058-77-0)
- 1-(3-Fluorophenyl)-3-[3-(tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]urea (CAS 874302-03-1)
- 11-(4-Chlorophenyl)-7,8-dimethyl-2,3,4,5,10,11-hexahydro-1H-dibenzo[b,e][1,4]diazepin-1-one (CAS 338415-05-7)
- Ruthenate(2-), hexabromo-, potassium (1:2), (OC-6-11)- (CAS 52637-67-9)
- 5-(Furan-2-yl)-1-methyl-1H-pyrazole-3-carboxylic acid (CAS 108128-39-8)
- (S)-1-(2-fluoro-6-(trifluoromethyl)phenyl)ethan-1-amine (CAS 1241679-82-2)
- 1-((3-Chlorobenzyl)oxy)-2-(4-chlorophenyl)-1H-benzo[d]imidazole (CAS 338791-24-5)
- Adefovir Impurity 7 (CAS 1215101-40-8)
- tert-Butyl 3-{[(4-chlorophenyl)methyl]amino}propanoate (CAS 1221341-35-0)
- Stresscopin-Related Peptide (human) (CAS 348626-74-4)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com