[Tyr0] Corticotropin Releasing Factor, human, rat CAS 100915-92-2
| CAS No. | 100915-92-2 |
| Molecular Formula | C209H346N60O62S2 |
| Molecular Weight | 4755.00 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
CATO manufactures [Tyr0] Corticotropin Releasing Factor, human, rat under ISO 17034:2016 accreditation with dual CNAS and ANAB accreditation. Each batch is characterized by orthogonal methods and supplied with a full Certificate of Analysis (COA), ensuring metrological traceability.
[Tyr0] Corticotropin Releasing Factor, human, rat (CAS 100915-92-2), molecular formula C209H346N60O62S2 and molecular weight 4755.00 g/mol, is a CATO reference standard with documented purity and traceability.
The molecular framework of [Tyr0] Corticotropin Releasing Factor, human, rat (C209H346N60O62S2) is characterized by a nitrogen-containing heterocyclic scaffold, an amide group, a sulfone group, a hydroxyl group, an ether linkage. In reversed-phase chromatography, its retention is governed primarily by the protonation state of its nitrogen-containing groups, which provides a practical basis for HPLC-UV/DAD or LC-MS method development. The presence of an aromatic ring or conjugated system gives the compound characteristic absorption bands in the UV-Vis region, making it well suited to UV or diode-array detection (DAD).
This reference standard is suitable for quantitative analysis on major chromatographic platforms including HPLC, GC, LC-MS/MS, and GC-MS, serving as an external calibration standard or a system suitability test reference material.
Physical & Chemical Properties
| Molecular Formula | C209H346N60O62S2 |
| Molecular Weight | 4755.00 g/mol |
| Purity | >95% |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 67.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| CAS Registry Year (est.) | 1985 |
| Nitrogen Atoms | 60 |
| Sulfur Atoms | 2 |
Related Tyr Standards
Recommended Standards
- TEPQEESEEEVEEPEERQQTPEVVPDDSGTFYDQTVSNDLE (CAS CATO-CPTD788896)
- CRF (human, rat) acetate salt (CAS 86784-80-7)
- Retatrutide (CAS 2381089-83-2)
- Thymosin b10 (human, rat) (H-2928.0500) (CAS 88160-82-1)
- Cobalt(III) fluoride (CAS 10026-18-3)
- 53E6MN32Z5 23235-61-2 Ditrimethylolpropane 2,2'-(Oxybis(methylene))bis(2-ethylpropane-1,3-diol) 1,3-Propanediol, 2,2'-(oxybis(methylene))bis(2-ethyl- EINECS 245-509-0 UNII-53E6MN32Z5 EC 245-509-0 (CAS 23235-61-2)
- 2,3-Diiodonaphthalene-1,4-dione (CAS 13148-47-5)
- Methyl 3-(3-amino-1H-1,2,4-triazol-5-yl)-propanoate hydrochloride (CAS 1332528-76-3)
- Lidocaine Impurity 50 (CAS 27794-54-3)
- 2-Bromo-2-iodo-1,1,1-trifluoropropane (CAS 1309602-72-9)
- tert-butyl N-(azepan-4-ylmethyl)carbamate (CAS 1408074-78-1)
- 2-Chloro-N-(2-chloroethyl)acetamide (CAS 13627-28-6)
- 3-(Boc-amino)indole (CAS 1199215-71-8)
- Tumor Targeted Pro-Apoptotic Peptide (CAS 1926163-30-5)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com