Corticotropin Releasing Factor bovine CAS 92307-52-3
| CAS No. | 92307-52-3 |
| Molecular Formula | C206H340N60O63S |
| Molecular Weight | 4697.33 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
As a certified reference material (CRM), Corticotropin Releasing Factor bovine meets the metrological traceability requirements of ISO/IEC 17025 laboratories. Batch-to-batch consistency is monitored via control charts to guarantee comparable assigned values across lots.
Corticotropin Releasing Factor bovine (CAS 92307-52-3) is a high-purity analytical reference standard with the molecular formula C206H340N60O63S and a molecular weight of 4697.33 g/mol.
Corticotropin Releasing Factor bovine (C206H340N60O63S) contains a nitrogen-containing heterocyclic scaffold, an amide group, a sulfone group, a hydroxyl group, an ether linkage. It is notably hygroscopic, the carboxyl group imparts weak acidity; these physicochemical properties determine the optimal preparation and storage of its standard solutions. The presence of an aromatic ring or conjugated system gives the compound characteristic absorption bands in the UV-Vis region, making it well suited to UV or diode-array detection (DAD).
This reference standard is suitable for quantitative analysis on major chromatographic platforms including HPLC, GC, LC-MS/MS, and GC-MS, serving as an external calibration standard or a system suitability test reference material.
Physical & Chemical Properties
| Molecular Formula | C206H340N60O63S |
| Molecular Weight | 4697.33 g/mol |
| Purity | 97%+ |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 67.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| CAS Registry Year (est.) | 1983 |
| Nitrogen Atoms | 60 |
| Sulfur Atoms | 1 |
Related Corticotropin Standards
Recommended Standards
- Urocortin (human) trifluoroacetate salt (CAS 176591-49-4)
- TKPQKKSKKKVKKPKKRQQTPKVVPDDSGTFYDQTVSNDLK (CAS CATO-CPTD788898)
- CRF (ovine) (CAS 79804-71-0)
- Retatrutide (CAS 2381089-83-2)
- Sodium (2S,3S,4S,5R,6R)-3,4,5-trihydroxy-6-methoxytetrahydro-2H-pyran-2-carboxylate (CAS 58189-74-5)
- (5-Methyl-2-(trifluoromethyl)furan-3-yl)methanamine (CAS 306935-05-7)
- (E)-3-(2-(3-Nitrobenzylidene)hydrazinyl)-1,2,4-triazin-5(4H)-one (CAS 300829-64-5)
- Irinotecan impurity 57 (CAS CATO-C4X-166757)
- (4S,5S)-5-Isopropyl-2-oxooxazolidine-4-carboxylic acid (CAS 125473-34-9)
- N-{3-[2-(methylamino)-1,3-thiazol-4-yl]phenyl}hexanamide (CAS 866040-78-0)
- 6,6-Difluoro-6,7-dihydro-5H-cyclopenta[b]pyridin-7-ol (CAS 2833708-31-7)
- 2-Bromo-4-fluoro-1-isothiocyanatobenzene (CAS 183995-72-4)
- 3-((Dimethylamino)methylene)chroman-4-one (CAS 1340477-34-0)
- Smac-N7 Peptide (CAS 401913-57-3)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com