Amyloid β-Protein (1-43) CAS 134500-80-4
Purity >95%In StockPharmaceutical Standards
| CAS No. | 134500-80-4 |
| Molecular Formula | C207H318N56O62S |
| Molecular Weight | 4615.00 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
Amyloid β-Protein (1-43) (CAS 134500-80-4) reference standard, produced by CATO (ISO 17034 / CNAS / ANAB accredited). Molecular formula: C207H318N56O62S. Molecular weight: 4615.00 g/mol. Trusted by 10,000+ laboratories worldwide for pharmaceutical analysis and QC.
Physical & Chemical Properties
| Molecular Formula | C207H318N56O62S |
| Molecular Weight | 4615.00 g/mol |
| Purity | >95% |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 77.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| CAS Registry Year (est.) | 1995 |
| Nitrogen Atoms | 56 |
| Sulfur Atoms | 1 |
Related Amyloid Standards
- Amyloid β-Protein (1-42) (CAS 107761-42-2)
- Amyloid β-Protein (42-1) (CAS 317366-82-8)
- Amyloid β-Protein (1-42) (mouse, rat) (CAS 166090-74-0)
- (Lys22)-Amyloid β-Protein (1-40) trifluoroacetate salt (CAS 302905-01-7)
- (Pyr3)-Amyloid β-Protein (3-42) (CAS 183449-57-2)
- Amyloid β-Protein (1-46) (CAS 285554-31-6)
- Amyloid β-Protein (1-40) (mouse, rat) (CAS 144409-98-3)
- (Pyr3)-Amyloid β-Protein (3-40) trifluoroacetate salt (CAS 161818-04-8)
Recommended Standards
- TDPQDDSDDDVDDPDDRQQTPDVVPDDSGTFYDQTVSNDLD (CAS CATO-CPTD788897)
- Des-Pro-Pro-Tirzepatide (CAS CATO-CPTD788696)
- GHRF (1-40), human (CAS 84069-10-3)
- tert-Butyl ((1S,3R)-3-(aminomethyl)cyclopentyl)carbamate (CAS 774213-03-5)
- 2-(Methylamino)pyrimidine-4-carboxylic acid (CAS 89691-96-3)
- 2-((3-Aminobenzyl)oxy)acetic acid (CAS 1355219-78-1)
- α-Methyl-6-benzofuran Ethanamine HCl (1mg/mL in Methanol)(6-APB HCl) (CAS 286834-84-2)
- (1R,2r)-2-(methoxycarbonyl)cyclopentanecarboxylic acid (CAS 111138-68-2)
- 7443-52-9 Cyclohexanol, trans- NSC-244887 NSC244887 trans-2-Methylcyclohexanol (CAS 7443-52-9)
- [Tyr15] Fibrinopeptide B, human (CAS 125455-56-3)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 13829788188 / jacky.chen@cato-chem.com