Des-Pro-Pro-Tirzepatide CAS CATO-CPTD788696
| CAS No. | CATO-CPTD788696 |
| Molecular Formula | C215H334N46O66 |
| Molecular Weight | 4619.22 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
Based on its molecular formula C215H334N46O66, Des-Pro-Pro-Tirzepatide contains a nitrogen-containing heterocyclic scaffold, an amide group, a hydroxyl group, an ether linkage; these features give the compound characteristic absorption bands in UV spectroscopy. The molecular weight of 4619.22 g/mol is directly relevant to the identification of the molecular ion in mass spectrometry. Nitrogen-containing functional groups confer excellent ionization efficiency in positive-ion electrospray (ESI) mode, making the compound well suited to LC-MS/MS analysis.
CATO supplies Des-Pro-Pro-Tirzepatide (CAS CATO-CPTD788696), a certified reference material (molecular formula C215H334N46O66, MW 4619.22 g/mol) for analytical method development and quality control.
This reference standard is suitable for quantitative analysis on major chromatographic platforms including HPLC, GC, LC-MS/MS, and GC-MS, serving as an external calibration standard or a system suitability test reference material.
As a certified reference material (CRM), Des-Pro-Pro-Tirzepatide meets the metrological traceability requirements of ISO/IEC 17025 laboratories. Batch-to-batch consistency is monitored via control charts to guarantee comparable assigned values across lots.
Physical & Chemical Properties
| Molecular Formula | C215H334N46O66 |
| Molecular Weight | 4619.22 g/mol |
| Purity | >90% |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 72.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| Nitrogen Atoms | 46 |
Recommended Standards
- Amyloid β-Protein (1-43) (CAS 134500-80-4)
- Des-Tyr10-Tirzepatide (CAS CATO-CPTD788680)
- TDPQDDSDDDVDDPDDRQQTPDVVPDDSGTFYDQTVSNDLD (CAS CATO-CPTD788897)
- Amyloid β-Protein (1-42) (CAS 107761-42-2)
- 2-(3-((Benzyl(methyl)amino)methyl)piperidin-1-yl)ethanol (CAS 1269165-29-8)
- 2,4-Diphenyloxazole (CAS 838-41-5)
- 1-[4-(Piperidin-3-ylmethoxy)benzoyl]piperidinehydrochloride (CAS 1332531-15-3)
- 4-(Chloromethyl)-6-(trifluoromethoxy)-3-(trifluoromethyl)pyridine-2-sulfonyl chloride (CAS 1805285-95-3)
- 5-[3-(4-Methoxy-phenyl)-propyl]-4-methyl-4H-[1,2,4]triazole-3-thiol (CAS 758705-11-2)
- 4-Methyl-2-(thiazol-4-yl)phenol (CAS 906733-61-7)
- 4-(Difluoro(3,4,5-trifluorophenoxy)methyl)-4'-ethyl-1,1'-bi(cyclohexane) (CAS 208338-49-2)
- (S)-Benzyl 2-((2-methoxy-2-oxoethyl)carbamoyl)pyrrolidine-1-carboxylate (CAS 61058-42-2)
- 3-(4-Hydroxy-3-methyl-phenyl)propanenitrile (CAS 22516-99-0)
- Palmitoyl Tripeptide-1 TFA salt (CAS 2803375-47-3)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com