Urocortin (human) trifluoroacetate salt CAS 176591-49-4
| CAS No. | 176591-49-4 |
| Molecular Formula | C204H337N63O64 |
| Molecular Weight | 4696.24 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
Urocortin (human) trifluoroacetate salt (CAS 176591-49-4), molecular formula C204H337N63O64 and molecular weight 4696.24 g/mol, is a CATO reference standard with documented purity and traceability.
Structurally, Urocortin (human) trifluoroacetate salt (C204H337N63O64) contains a nitrogen-containing heterocyclic scaffold, an amide group, a hydroxyl group, an ether linkage. The molecule exhibits a degree of unsaturation (DBE) of 68.0, corresponding to approximately 68 ring(s) or double-bond equivalent(s). With a molecular weight of 4696.24 g/mol, it falls into the high-molecular-weight range. The aromatic system may exhibit native fluorescence, enabling detection with a fluorescence detector (FLD).
Recommended for analytical method development and validation; each product is supplied with a full Certificate of Analysis (COA) ensuring ISO 17034 metrological traceability.
As a certified reference material (CRM), Urocortin (human) trifluoroacetate salt meets the metrological traceability requirements of ISO/IEC 17025 laboratories. Batch-to-batch consistency is monitored via control charts to guarantee comparable assigned values across lots.
Physical & Chemical Properties
| Molecular Formula | C204H337N63O64 |
| Molecular Weight | 4696.24 g/mol |
| Purity | 97%+ |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 68.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| CAS Registry Year (est.) | 2007 |
| Nitrogen Atoms | 63 |
Related Urocortin Standards
Recommended Standards
- CRF (ovine) (CAS 79804-71-0)
- Corticotropin Releasing Factor bovine (CAS 92307-52-3)
- Amyloid β-Protein (1-42) (CAS 107761-42-2)
- TKPQKKSKKKVKKPKKRQQTPKVVPDDSGTFYDQTVSNDLK (CAS CATO-CPTD788898)
- N-(4-Methyl-2-(morpholinosulfonyl)phenyl)-2-(methylthio)nicotinamide (CAS 380570-15-0)
- 2-(Aminomethyl)-6-iodoisonicotinonitrile (CAS 1393581-86-6)
- N2-Isopropylpyridine-2,3-diamine hydrochloride (CAS 1353987-08-2)
- 3-(Difluoromethyl)isonicotinaldehyde (CAS 1211541-96-6)
- 4-Bromo-5-methoxy-2-(trifluoromethyl)quinoline (CAS 587885-89-0)
- Ethyl imidazo[1,2-b]pyridazine-2-carboxylate, 97% (CAS 123531-27-1)
- 5-Phenyl-1H-tetrazol-1-ol (CAS 55513-24-1)
- 1-(9H-Fluoren-2-yl)-1H-pyrrole-2,5-dione (CAS 59634-77-4)
- (2E)-3-(2,5-Dimethoxyphenyl)acrylic acid (CAS 38489-74-6)
- 110207-62-0 Acetyl-Cholecystokinin Octapeptide (2-8) (sulfated) MFCD00133565 (CAS 110207-62-0)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com