Erythromycin Z Oxime CAS CATO-C4X-100129
| CAS No. | CATO-C4X-100129 |
| Molecular Formula | C37H68N2O13 |
| Molecular Weight | 748.94 g/mol |
| Category | Pharmaceutical Standards / API Standards |
| Availability | In Stock |
Chemical Structure
Description
Compared with other compounds in its class, the molecular weight of 748.94 g/mol gives Erythromycin Z Oxime distinctive chromatographic separation conditions and mass-spectrometry parameter settings.
CATO supplies Erythromycin Z Oxime (CAS CATO-C4X-100129), a certified reference material (molecular formula C37H68N2O13, MW 748.94 g/mol) for analytical method development and quality control.
The molecular framework of Erythromycin Z Oxime (C37H68N2O13) is characterized by a nitrogen-containing heterocyclic scaffold, an amide group, a hydroxyl group, an ether linkage. In reversed-phase chromatography, its retention is governed primarily by the protonation state of its nitrogen-containing groups, which provides a practical basis for HPLC-UV/DAD or LC-MS method development. Nitrogen-containing functional groups confer excellent ionization efficiency in positive-ion electrospray (ESI) mode, making the compound well suited to LC-MS/MS analysis.
Recommended for analytical method development and validation; each product is supplied with a full Certificate of Analysis (COA) ensuring ISO 17034 metrological traceability.
The assigned purity is verified by mass-balance and quantitative NMR (qNMR) approaches, with the expanded uncertainty reported at a 95% confidence level (k=2). Batch homogeneity and stability are independently assessed for every lot.
Physical & Chemical Properties
| Molecular Formula | C37H68N2O13 |
| Molecular Weight | 748.94 g/mol |
| Purity | 97%+ |
| Storage | Store in a cool place (≤25°C), protect from light, keep sealed and dry |
| Solubility (reference) | Soluble in DMSO, DMF, methanol |
| Stability | May oxidize slowly on prolonged air exposure; Light-sensitive; avoid direct strong light; Hygroscopic; reseal immediately after opening |
| Degree of Unsaturation (DBE) | 5.0 |
| UV Absorption | UV-absorbing |
| Structural Features | Aromatic ring present |
| Nitrogen Atoms | 2 |
Related Erythromycin Standards
- (9Z)-Erythromycin A Oxime (CAS 134931-01-4)
- Erythromycin Impurity 39 (CAS CATO-C4X-100139)
- Erythromycin thiocyanate impurity C reduced derivative (CAS CATO-C4X-100167)
- Erythromycin A 9-Oxime (Mixture of Z and E Isomers) (CAS 13127-18-9)
- Erythromycin EP Impurity H（Erythromycin A N-oxide） (CAS 992-65-4)
- Erythromycin Impurity 46 (CAS CATO-C4X-100146)
- Erythromycin EP Impurity A (CAS 82230-93-1)
- Erythromycin Impurity 50 (CAS 37152-22-0)
Recommended Standards
- 3beta-[(alpha-L-Arabinopyranosyl)oxy]ursa-12,19(20)-dien-28-oic acid beta-D-glucopyranosyl ester (CAS 686776-47-6)
- 138995-23-0 Ilexsaponin B1 (CAS 138995-23-0)
- Clarithromycin EP Impurity J(Roxithromycin EP Impurity C) (CAS 111321-02-9)
- PHF6 (CAS 329897-62-3)
- 5-Chloro-3-nitropicolinamide (CAS 856834-36-1)
- 3-Amino-N-(4-methyl-1,3-oxazol-2-yl)-6-(pyridin-4-yl)-4-(trifluoromethyl)thieno[2,3-b]pyridine-2-carboxamide (CAS 626225-38-5)
- 1-(2-Chloro-6-(trifluoromethyl)pyridin-4-yl)ethanone (CAS 1060810-89-0)
- 6-Chloro-2,2-dimethyl-2H-benzo[b][1,4]oxazin-3(4H)-one (CAS 124188-37-0)
- 7-(Benzo[d][1,3]dioxol-5-yl)pyrazolo[1,5-a]pyrimidine-3-carbonitrile (CAS 685106-66-5)
- 3,7-Di-tert-butylnaphthalene-1-sulfonamide (CAS 109688-05-3)
- 3-(tert-Butoxy)-2-isopropoxyphenol (CAS 1243364-05-7)
- 99210-65-8 CDLPQTHSLGSRRTLMLLAQMRRISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKE Interferon alpha 2b Intron A Sch 30500 (CAS 99210-65-8)
- 5-Bromo-4-methoxy-2,3-dimethylpyridine (CAS 1209458-25-2)
- Peptide Impurity 13 (CAS CATO-CPTD788813)
Why CATO?
- ISO 17034 accredited reference material producer (CNAS + ANAB dual accreditation)
- 130,000+ catalog items in stock, COA supplied with every batch
- Worldwide shipping with full export documentation (HS code guidance available)
- Technical support: +86 18665070610 / Nicole.chen@cato-chem.com